DPCstruct | MC53228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.59 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0431- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8HJH2 | 3-113 | RVIKRLVWDMCYDSQQHLSEGAQSVLVKSGPWQYSYRLWVEDVDGFELIFPPEVPFGTPHVPQTNKFYQKLMHRFFPTRGNLRCYEL… |
| A0A7J6B5Q8 | 23-138 | HFIKNKLWSLVATTRHYLQKGYTTVTLRDGDFYFCYFLWFENETGYKLEVVDIPNLPDDSAPIGMLAWDYYRKLLRYYSKSHQNELV… |
| A0A818LCC0 | 86-221 | None |
| A0A6A4VJ10 | 995-1154 | None |
| V5HXZ8 | 293-439 | None |
| T1DGI6 | 24-155 | None |
| A0A3Q0JDU0 | 125-293 | None |
| A0A2Y9N6F1 | 535-702 | None |
| A0A2Y9MR53 | 480-620 | None |
| L8HF34 | 858-1014 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.