DPCstruct | MC53226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 367 ± 91 aa |
| Standard deviation of domain lengths | 91.46 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 86.05 |
| Assigned Pfam label(s) | PF21680- CL0003- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6DJH4 | 19-328 | GFDIVRFKTGTPPRVNSDSIDYSKTEIQPGDDLPRAFSYETTEFIMDQLPCWLTYTNGETHQVIDDNLHLSAMYSGMIKGTGPRYCP… |
| A0A7J6AR81 | 516-994 | LDRGRYREFVQSQLLKMPRLTVIEGSVEDLIVLKEVLGLKLGRMRTGTPPRIIKDTIDFSLAKLHLPDPQPTPFSFVNRHTHCKPED… |
| A0A2S4WLA2 | 79-550 | None |
| A0A379B1M6 | 51-369 | None |
| A0A090VXD3 | 53-368 | None |
| A0A0G2DSZ5 | 148-580 | None |
| A0A6J8E032 | 39-356 | None |
| A0A1I7Z6S4 | 1-310 | None |
| A0A7S1NPD8 | 373-843 | None |
| A0A077ZHG4 | 689-1159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.