DPCstruct | MC53223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5NQS5 | 4-94 | PAADKQAQYVTANNDTLWEIAAKVRTGGTVQQTMLAIQALNPEAFIGGNINRLKKGQVLRLPTPQQTTALPQPQAVAEVSRQYSAWR… |
| A0A1W9L581 | 2-95 | VQYGPIKAGDRLWDIAGKVRPADASITRHQVMLALFRANARAFRVSCNIHSLLVVGKTLQIPSLAEMQAMSHTEAVTLFNQQQAVWK… |
| A0A3D2R480 | 161-260 | None |
| A0A1H8T1Y1 | 158-227 | None |
| K6G4J2 | 150-267 | None |
| A0A656SEX5 | 21-143 | None |
| A0A520U0J1 | 17-108 | None |
| A0A7Z0MBW7 | 150-279 | None |
| A0A2K8ZV29 | 252-354 | None |
| A0A6N8FCP5 | 13-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.