DPCstruct | MC5322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 2.24 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 51.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10488 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9X5T0 | 252-318 | KKVRFDTKPVVHVMHTWNYAYRAARKSEWGILINNRAHFKSRIQRVANELNPILSIEHRQKIYETRF |
| A0A1B0DBA5 | 5-73 | REVRFNLKPEVHVIRAWDFAYRTARKGHWEQVARDRERFGKRILSLGHVLSPILEKSHREKMYLERFCD |
| A0A6P3YBQ1 | 83-151 | None |
| A0A7E4SG05 | 1-70 | None |
| D2A5U3 | 139-208 | None |
| U4TY70 | 383-452 | None |
| B4LP12 | 192-258 | None |
| A0A834JLY0 | 144-212 | None |
| A0A6P8Y654 | 293-364 | None |
| A0A0C9R4Y5 | 492-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.