DPCstruct | MC53218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 471 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.90 |
| Pfam Score | 88.07 |
| Assigned Pfam label(s) | CL0751- CL0466- PF10748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5GQB6 | 16-106 | LCFRPYQVNAQVQSQKKITIEISNERLPSVLKRLEKLSGYKILFTYDDVKKFTVSGSVKDKSIEQTLDIILANKPLEYHIEDQFITI… |
| A0A518G4W7 | 520-600 | MDEYLLSIEAKSNPLSEVCQQFQEQIGQEVAIDTNSLSQIGLVDPRITLSLAGVSASDALDLALNPIECTWVEKDGIITVV |
| A0A1C7YVE8 | 7-110 | None |
| A0A4R6WRJ6 | 14-127 | None |
| A0A2S7E4T2 | 1-99 | None |
| A0A7X1AX54 | 96-195 | None |
| A0A1I4T0K3 | 282-371 | None |
| R6YCU3 | 10-110 | None |
| A0A3L7PE78 | 634-749 | None |
| E7GQG4 | 112-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.