DPCstruct | MC53211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 23.75 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832JYC5 | 15-144 | PKPGLRLYIGKDVPRQLVRILRRISYQELTENAKFTLEKVVEEIVKEREAELVEFINTCGPLTPRLHALEALPGIGKKISMRLIEER… |
| A0A832CTF2 | 168-273 | LKYEDLTDIAKNNLLEAIKTIISSEEKVYVEFFNIADAINIRLHVLELFKGVGKRTLSNFLDRRKQKSFESFEEVKKVLKIDPVEAI… |
| A0A7J3WQ23 | 3-116 | None |
| A0A2H9QBV5 | 35-184 | None |
| A0A7G2D467 | 75-244 | None |
| A0A843GDI6 | 1-136 | None |
| A0A2R4ZTX8 | 13-197 | None |
| A0A2E5QDU7 | 107-243 | None |
| A0A2E6PYD9 | 16-172 | None |
| G0QBT6 | 9-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.