DPCstruct | MC53203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5Y454 | 2-118 | PISPKATRETVQALAGFNDIQMDRFYVVTKEVAKKLVHEDFTITWKQMKANRKIEAIRGIELQLLEDDFPMISEKTFSEIVNWRMTR… |
| A0A6A5W891 | 1-134 | MPPHLPTLPRNATAKEARAAAGLDFFHWEQFYEITREEAEDLLKRYPNCTWASLSYTEKEASHDRVTDRLKASKIEEVRRDILRWRM… |
| A0A2I0RJ38 | 1-144 | None |
| A0A6A5VTX0 | 2-102 | None |
| A0A6G1IQV2 | 3-146 | None |
| A0A6A6SW70 | 1-144 | None |
| A0A6A6XWP3 | 51-207 | None |
| M2U9L6 | 1-152 | None |
| A0A6A6SIZ3 | 9-88 | None |
| A0A6G1II99 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.