DPCstruct | MC53202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 170 ± 29 aa |
| Standard deviation of domain lengths | 28.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5W3Y9 | 1-177 | MTTAETKFSLLDLPPELRLKVYSHISPSLDCHPWHYQGLLLSCRQIQLEVEDEAVKSMVRYLKGVADAWDTIFTLPLGIKMPTSFAN… |
| A0A6A7A2M7 | 24-247 | SAVDPTSILPQPASRLLSLPTELRLLVCSYMTLSPEYTESLAFRGAYLSCRLLHQDMRNALVPEQDLVKYMASKRQLWTPAVHTNVS… |
| A0A6A5W6I0 | 1-170 | None |
| A0A178AG70 | 5-155 | None |
| A0A6A5VWW6 | 60-216 | None |
| A0A178ADY8 | 1-174 | None |
| A0A6A5WFS5 | 1-166 | None |
| A0A7U2I7M6 | 11-247 | None |
| A0A6A7A120 | 1-133 | None |
| A0A6A7A2F0 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.