DPCstruct | MC532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 258 ± 32 aa |
| Standard deviation of domain lengths | 32.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6UNE1 | 2-196 | LPFLLCAVTAMLYVFVMTGFQAEKYRTLTQQAQTLAVTVGQGADEGDPYTRLYAYDQVTLPFAAFSFGSRSVVQRVVVRDWVGYTGE… |
| R9JP37 | 53-322 | IMKMAYPQKYINNKDSDQEQASMSGPKGSMTVEASLTIPIFLFAVLCLIYLLEVQAVRISVHSAAQGAAKNAAEDIVTLPVLNLFKL… |
| A0A1I0RCX9 | 33-318 | None |
| A0A3A6L642 | 1-252 | None |
| A0A4R1MK52 | 112-389 | None |
| A0A3D0M6Z2 | 2-303 | None |
| A0A1G9FNX8 | 80-376 | None |
| A0A7C6UDS5 | 4-256 | None |
| A0A1I5WKB9 | 4-235 | None |
| A0A1G5XUV7 | 72-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.