DPCstruct | MC53198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 97 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF12008- PF12161- PF11867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9VUF1 | 75-155 | MFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFGNIVTFRDLERPTIDAITLFGDKNTKNVVLEKSYEEYMQ |
| A0A1E7PPH3 | 1-106 | MMLTGFDAPPLHTLYLDRPLKSALLMQTLARVNRKFRQKESGLLEAYAPLIDNLQAAIAEFTKSSSDEDEKVIGQNIEEALVIVRGF… |
| A0A1H6J4P7 | 45-136 | None |
| A0A511D1V6 | 333-422 | None |
| A0A847CBL5 | 57-186 | None |
| A0A1S2NJI6 | 1-82 | None |
| A0A0A0M635 | 203-294 | None |
| A0A378VYE5 | 104-182 | None |
| A0A7Y0RPF2 | 2-76 | None |
| A0A7X6KIN1 | 20-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.