DPCstruct | MC53194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 175 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Z8DGK9 | 116-242 | SDQSWMLYRLAGSIYINNLLMEKGEMELALGDELAFEDTFFKFYADEVLVAGPVEASDELARKSVSRYAFYEDYPDYHRSPRIIYRS… |
| A0A6L7EH07 | 1-129 | WYVMPQDETIYVNGKKIHGPEKIYAGDELFWNFLTVTFKDDDLLQVTAYEPFHTRLEKTRPPSTETKQKYPSYRRTPRLIYDLPDDR… |
| D4IYZ0 | 148-317 | None |
| W1VR79 | 3-175 | None |
| A0A496KDZ1 | 110-295 | None |
| A0A7L4WDU9 | 125-302 | None |
| A0A0R2CTF3 | 131-322 | None |
| A0A2R7ZTD1 | 2-175 | None |
| A0A316BB44 | 126-303 | None |
| A0A1L8WRR0 | 27-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.