DPCstruct | MC53181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9M900 | 1-97 | MIHPYLVYETYKQLIADEAISISFDEAVTKFGKSVTEGVVKVMSKVGISTVQSYRGAQIFEAVGISEDVIQAYFTGTASQLGGIDLD… |
| A0A7Y0WZ89 | 233-324 | PYLAYEALGKLIDDGALDKDYRDVMQNYQYGINKGLYKIMSKMGISTIASYRCSQLFEAVGLSREVVDLCFKGVTTRIEGANFDDFQ… |
| A0A809WN68 | 41-135 | None |
| A0A444X8H1 | 1-111 | None |
| A0A376FFX0 | 9-103 | None |
| A0A1W9F2M8 | 70-163 | None |
| A0A4Q2HQF9 | 46-139 | None |
| A0A1D6MBZ9 | 434-538 | None |
| A0A090X506 | 300-385 | None |
| A0A6J1W9E8 | 13-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.