DPCstruct | MC53180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0031- CL0166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9M8L8 | 33-175 | RLIYHISMINELTDSIKKAQPEVFEITQKVACHLEKAACSKLSDHEIAYLAMHFGSWMRREGISSIARRSVYIVCGEGIGTSNMLKT… |
| A0A829XJ55 | 1-133 | MTYFAEANPLFHQIILTFTTKQETDLDWRKQASLYYDYMFACIEDIPLEILKDRVYICVDFSQGRLYNQYMKKTVNYFNNLNIEVQT… |
| A0A386PW48 | 316-473 | None |
| A0A413AL54 | 148-311 | None |
| A0A2L1TY20 | 357-508 | None |
| W7AYB0 | 4-122 | None |
| A0A1S1BP42 | 147-324 | None |
| A0A381H917 | 133-273 | None |
| A0A242CDI5 | 120-261 | None |
| A0A7U8INL8 | 73-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.