DPCstruct | MC53178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3D9B6 | 4-91 | AGLALLAPTPYILEGPGPAVDLLGEREGRPVLRVEGGEADPGEGTLDMTTVMVGGPPIGTTSLLDLGRGLTDPAVDVVPRELMYPTGV |
| A0A5S9M843 | 7-88 | RWLSFFVVVLVLFGLTFVKLPYYVTKPGDATEIAPHIQVDGGYGEKGSFSLMTIKVGPANPYTYLLAKMNKYDEIVPEEKIL |
| A0A538JGK8 | 2-133 | None |
| A0A1I3R7B1 | 1-87 | None |
| W7BUS7 | 6-79 | None |
| A0A359F532 | 144-253 | None |
| A0A365V3H5 | 2-97 | None |
| A0A5C8IEW8 | 1-92 | None |
| A0A1Q6NVQ7 | 16-121 | None |
| W7YFG3 | 10-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.