DPCstruct | MC53177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 16.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9M7A4 | 5-125 | ESVIHLLQMDAIEFEFGYGLIPLADANQGGDLLDRIVMIRRQLALELGLVIPIVRIRDNIALNPNEYRLKIKGNEVAKGELLLDHYL… |
| A0A090QYF9 | 110-237 | SSDIPHIHAMNLHVGYRLVSLIDRQQGAELLNRLLGIRKTLTEQRGFVIPHIHIRDDLALNANQYQITVRGAVAVSAEVEVDKLLAI… |
| A0A376RNJ2 | 102-236 | None |
| T0DUK7 | 183-279 | None |
| I0X5R7 | 1-113 | None |
| A0A6L5C5S0 | 311-448 | None |
| A0A447N4Z1 | 25-156 | None |
| A0A381H8J3 | 236-387 | None |
| A0A1F6LCG3 | 511-625 | None |
| A0A2M7G9Y4 | 76-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.