DPCstruct | MC53171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 116 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1E6Z9 | 2-103 | HYIACGASHQPCAGTIETADNDEYHEVRCCSDSLIQGWNKRNGCDVWSASQVPICFHKENFVGAKSVCAVHGARLCSTEELLSDCSR… |
| A0A7S0EHH7 | 71-186 | PPLMSPSPPSPQKRPVECGRPDQCSETAGLRDPDELHEVRCCADVKPSASWPPRQSGCSVWGESNVGSWQCAYRKTFAEAEEICQAA… |
| A0A7S2A7A8 | 388-511 | None |
| A0A7S3SSG5 | 43-155 | None |
| A0A7S0F2N1 | 1-89 | None |
| A0A7S2E9S3 | 95-229 | None |
| A0A7S2EG70 | 505-589 | None |
| A0A7S2EIE8 | 2-91 | None |
| A0A7S2EL83 | 17-131 | None |
| A0A7S3SUP4 | 359-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.