DPCstruct | MC5317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF08718- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8JLM9 | 336-475 | ELWNVAYKTVEKHFSPKSVYERKHVAVLILDSKWDPASQVITGHAALGGGSGFIQMGIFGSHSLHSWPKFIEDVVPSLTDCTRTDTR… |
| A0A1B0D570 | 1-155 | MPDCQNRKFVAFIGCTRYHGSKDADYSYESIRAATVANAALASGGLALLGSGTLFSWPERLCDVRVYLEDETCVPLDELMDDSGYRR… |
| A0A212F9I8 | 192-363 | None |
| A0A7J7JAF5 | 4-181 | None |
| A0A443RI05 | 301-466 | None |
| B4H3A9 | 199-379 | None |
| A0A660UVN9 | 201-348 | None |
| A0A7R9CRH3 | 334-534 | None |
| D6X172 | 1-180 | None |
| A0A1B6D7B1 | 183-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.