DPCstruct | MC53167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 184 ± 39 aa |
| Standard deviation of domain lengths | 39.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I3ZCB3 | 23-233 | LEHDANSPAGGKPGRASPPNSRIGAWFRLLKSTAANNNLLPEFEVTLEATHHGPWTEVPAMFVEIGSTEDYWRREDAAATVASVFMK… |
| A0A662M9Z3 | 74-270 | ILVFLSRHSSATKIRTLTVHPVGNYNENPYGGLPRTLVYAEPYLMSETLRHLYKKSKDLDYRCSYEVTHHGPYVSSRTFFIEIGSSE… |
| A0A7X6VMU3 | 4-161 | None |
| A0A5E4L4G5 | 80-273 | None |
| A0A445ALY0 | 75-309 | None |
| A0A7J7FZC8 | 1-171 | None |
| A0A7M3ZSK2 | 164-400 | None |
| A0A4S4CXT0 | 35-176 | None |
| A0A7C1Q490 | 3-156 | None |
| A0A537HNU4 | 27-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.