DPCstruct | MC53163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.66 |
| Pfam Score | 61.67 |
| Assigned Pfam label(s) | CL0067- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8LRB6 | 15-141 | TCNPKPPDFSPDALVVLDTGPEALAGSTRLKAGSATKMALNSITTAAMVKCGKVYGNRMVDLKPWSAKLKARAARLVSELGGVDEDR… |
| A0A829H5X6 | 24-166 | FAQQTKALAISVACVPNSVLAQHADIAIAPVVGPEVITGSTRMKAGTAQKMVLNMLSTGVMIRAGKVFENLMVDVLPTNAKLVDRAE… |
| A0A7Z9LSG8 | 13-130 | None |
| A0A4Q2XXF0 | 244-381 | None |
| A0A6C1NUZ3 | 220-359 | None |
| A0A1F3M0A5 | 131-267 | None |
| A0A6V8H7G8 | 160-308 | None |
| A0A3D3S8G8 | 1-109 | None |
| A0A1W1WPT4 | 492-632 | None |
| A0A6H9LHZ8 | 35-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.