DPCstruct | MC5316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 225 |
|---|---|
| Mean domain length (aa) | 86 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0D3U8 | 3-113 | VIGSVAVDRDGRRIGKGNGYVDLDFALLVHCGVITNDTLIVTTVHDAQVLYLSVSDSLPGDLFKSYDVPVDMIVTPTEVIRVAKRLK… |
| A0A847DRS9 | 135-204 | APTVMVAPCLGFDARGWRLGYGGGYYDRTLAALPVPAAGAAYDACEVSLEPEPHDRRLSAIVTESRLLRC |
| A0A350IWK3 | 88-152 | None |
| R9PMB7 | 156-245 | None |
| A0A1F1SB78 | 304-365 | None |
| A0A0S4PSN5 | 58-130 | None |
| A0A369KZK6 | 143-205 | None |
| A0A4S4D5G7 | 342-423 | None |
| A0A6N2DZX5 | 63-130 | None |
| S9R7F1 | 64-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.