DPCstruct | MC53151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 221 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09740 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8SV88 | 1-212 | MPFGLDLHYWGEDQPSAGKILKFTSEHRFWAPSEVEEEVENKEITEMLKTRYITFAGKFEPVKHKCRAPMPDGTLCERQDRIKCPFH… |
| A0A2G5T7B8 | 93-303 | ASEDVKTPEKNSAKPKTDSQNLSAKVKSVPFGLDLKYWGEERKDVEVPKNNADCHRFWRSADESTVAGTVHDTVYRQRQFTFVGEAP… |
| A0A455BHN1 | 254-489 | None |
| A0A132A6D9 | 96-270 | None |
| A0A5N5SIW6 | 402-621 | None |
| A0A6P6BLQ6 | 465-675 | None |
| A0A7R9QPK7 | 264-470 | None |
| J9EH97 | 20-229 | None |
| A0A3L7INM2 | 24-261 | None |
| A0A7S2X2Z2 | 178-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.