DPCstruct | MC5315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0240- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4UP94 | 194-291 | VGEILSIVNSMGLMNIEVNDQQNKEISERFSQNLLFDPSSPEMAFAIREPVYNKTFKEIPPRGFAKRIFLKSRCSDGQLVLDGSITV… |
| A0A1B0D3Q1 | 13-144 | LSFHPRIYSNISSINRLSPKNVEELLTILQQGNHIGGHLDANVIAQEYNRRLVFPPDDPRLCYSIREEIRVGVWPNPKGDMESRAFA… |
| A0A401RHX3 | 128-246 | None |
| A0A0R3RYM9 | 103-221 | None |
| A0A3Q2CKZ7 | 182-289 | None |
| A0A7C3LN36 | 3-97 | None |
| A0A6P7FNM7 | 223-341 | None |
| A0A2P8YD07 | 256-376 | None |
| A0A3P8HE58 | 2-111 | None |
| A0A1I8AUG5 | 417-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.