DPCstruct | MC53147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4ZB17 | 2-112 | GAAGIVSLGGGTYKQQMAAASMALQSSLGMTCDTLANRVEAPCLGRNVTAASNALSSANMALADYDDLVPLNQVIDAMRQVGDLMPR… |
| A0A847FIA5 | 303-406 | AAAAVVEAAGGSAQQAVDAAAIAFQNTMGLVCDMVQGIVEIPCHTRNAAAAANAFLCADLILGGYQNPIPLDETVDAVMAVGQMLPR… |
| A0A2S0PBB1 | 162-251 | None |
| A0A2Z6QAN1 | 297-390 | None |
| A0A7D8Z9V6 | 296-404 | None |
| A0A1W9UZ87 | 2-99 | None |
| A0A7J2L367 | 183-303 | None |
| A0A2S8KA66 | 266-358 | None |
| A0A4Q4ZLC0 | 909-1010 | None |
| A0A564UIC6 | 351-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.