DPCstruct | MC53146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2PK13 | 1-51 | TGLTSRDGRVTIMMPHPERVFRAVQNSWRPEEWNEDAPWLRMFRNARVWVD |
| A0A7X2MS93 | 1-59 | PEWLTKRHHCLTNESGRVTIMMPHPERVFRTVSNSWHPAEWGEDSPWMRIFRNARRQLG |
| A0A524PA25 | 14-67 | None |
| A0A376SHT7 | 92-136 | None |
| A0A377LX98 | 56-105 | None |
| A0A7C7ZNW9 | 299-349 | None |
| A0A3M3WH68 | 1-42 | None |
| A0A4R4K1A9 | 8-65 | None |
| A0A3M5WQ69 | 380-430 | None |
| A0A7Y3EC96 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.