DPCstruct | MC53144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 218 ± 22 aa |
| Standard deviation of domain lengths | 21.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0023- CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4QI71 | 1-234 | MAIHDKRKGTNNDSIGEDCTDVTWTYRLEDGVCTDSLALVTAAKFGLSDRILKRANFLSEVVDEMGNVGESHIEKPVVSSYMTESNL… |
| A0A7R9ZRM9 | 1-203 | YRLEDGVCTDSLALVTAARFGLPKEIIDRADYFAGFLPGLEASSPSETAAADGCTNSESDNDFQSSSGTAATTGSADSSSSTMKDLT… |
| A0A4Q7K9K4 | 498-699 | None |
| D8QSF6 | 810-993 | None |
| A0A7S3WZB3 | 342-552 | None |
| A0A151U2U1 | 205-427 | None |
| A0A7S4HM64 | 745-1009 | None |
| A0A6A3C145 | 149-372 | None |
| A0A7S2UM94 | 775-994 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.