DPCstruct | MC53140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 15.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8BQM4 | 561-648 | LRSACNEASQTVDVYYEEETFSCSRDGEIIDTKKGLRIECPRIAVVCPSLSCPSNCSGKGVCDEDRDGKHSCICDDPFDVTAGCWGSQ |
| A0A7S0GJ75 | 1-105 | MIQTEHESEKTTADTNSITLTCRSDFEVLYTTLGYSITCPRIASVCIEMVCPSNCSGRGICDYTEDRPECICDDFMDESEGCWGDSR… |
| K0QZU9 | 641-717 | None |
| A0A7S0GAP6 | 3-99 | None |
| A0A7S2PAR6 | 1025-1108 | None |
| A0A7S4JCY8 | 674-786 | None |
| A0A7S2LBF0 | 81-194 | None |
| A0A7S2L7E6 | 86-207 | None |
| A0A7S3PZA8 | 626-746 | None |
| A0A7S2LKN2 | 48-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.