DPCstruct | MC5314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E335 | 69-131 | KSVYAYTDDDVFCIRITKNNMLQVIKTSYLQEWVKEYDKYVVRGKSICAFLSAVNLELFHRNT |
| A0A1B0D3D3 | 1-63 | MYAENEDDFLNFRLNESGVLDMLETEYSISLRDMMRTHLGAHNSLPAFLSALTMDLFNRTTIS |
| A0A7N9CHS4 | 583-650 | None |
| H9GGH9 | 197-265 | None |
| A0A6P8VK46 | 244-309 | None |
| A0A3Q0JAQ7 | 144-218 | None |
| A0A6P7YKH1 | 172-240 | None |
| A0A3Q0JAH1 | 1-76 | None |
| A0A6P8ESW4 | 58-126 | None |
| A0A0B7A767 | 303-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.