DPCstruct | MC53136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1FNW3 | 1-67 | MSSGHGGAHCGTSNCDSAWENVAGSGEHSCGDRIAWLQSSEGGLLSESEACGRVAGEFASVCGACMP |
| A0A7S1YET3 | 127-205 | WAVEPTSPCGCESCTANVLSRMGTDMSGTFSCGARISWLMRNGKSERDACSVVARNDFPNTCGQCDPGRCAPLRDGGGT |
| A0A1E7FZ67 | 133-210 | None |
| R1FEW5 | 294-390 | None |
| R1DNU1 | 244-339 | None |
| R1D9K2 | 595-658 | None |
| A0A7S0UHJ1 | 585-668 | None |
| K0TR72 | 459-540 | None |
| A0A7S2RAD5 | 268-368 | None |
| A0A7S0L7P9 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.