DPCstruct | MC53131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A480AS57 | 5-174 | VAVLQAVFTEIAETRMAGLPVCNPRLEVEALGFEPVRQADLRASGLAGPAAVADGRHWLPPLCLGVLVTPWFMNLVCLPLLRDDRCP… |
| A0A510X6D8 | 12-135 | LQQLAQRYSQRFAAEIHRSPHYNDRLRVDLLCFQPFAGEWCGALLTPVSLSLVLVSPTPGGFDAEAPPRLVDLPGGGYPFEPVDLGE… |
| A0A3C0KF49 | 27-198 | None |
| A0A3E1R6B4 | 14-186 | None |
| R7KF26 | 8-146 | None |
| A0A381GF84 | 11-123 | None |
| A0A2Z6DZA7 | 14-159 | None |
| A0A139K3N8 | 68-219 | None |
| A0A0K8P838 | 24-227 | None |
| A0A2Z6IB49 | 16-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.