DPCstruct | MC53120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 353 |
|---|---|
| Mean domain length (aa) | 228 ± 38 aa |
| Standard deviation of domain lengths | 38.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 15.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3DNT9 | 5-224 | KQMKLNSVEGFAEKGPFVSGSDISFFELKKDLSKTDRVFETKTDSRGKFVIETSTNFISKYVKLSVSGLYFNEVTGDISDMPITLEA… |
| A0A090PQ14 | 51-267 | QWSISGQAVANNINGATVRVFAIEAGVKGTDLTKTAGTTDASGAFSMTIVPTPLPVMMEITGGTYQDEATGNTLTNSSLTSVLPEIA… |
| A0A7R7IZF3 | 18-224 | None |
| A0A6S6M7W2 | 21-198 | None |
| A0A0B8P228 | 1-216 | None |
| A0A3L8BUE5 | 2-256 | None |
| A0A349MGD1 | 57-301 | None |
| A0A3L7PCD4 | 6-245 | None |
| A0A7X7BEL1 | 10-195 | None |
| A0A521XWH3 | 8-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.