DPCstruct | MC5312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 198 ± 32 aa |
| Standard deviation of domain lengths | 31.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2K5Q3 | 3-170 | QDTLSIICISYFTAFLGEGLTWLFVYRTEKYQKLKAEVDKQSKRLERQRDASELSIDRTAKKRLEKQEERLKNINRELSMVKMKSVF… |
| A0A1B0D1D1 | 15-236 | FLPIVVITFLVGIIRHYVSMLISSQKKVELTQIQDSQAMIRARLLRENGKYLTSQAFAMRRHYFNNEETGYFKTQKRPPVSPNSTAM… |
| A0A2D4PV25 | 1-127 | None |
| A0A6A4K3S1 | 485-714 | None |
| A0A0L8VMC0 | 299-536 | None |
| A0A6P8VDS2 | 4-164 | None |
| A0A7R9A6D2 | 1-179 | None |
| A0A090L5H1 | 62-288 | None |
| A0A177BC01 | 115-315 | None |
| A0A1V8SYR0 | 2-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.