DPCstruct | MC53113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 54.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376VFE6 | 142-252 | PEKCDLNSILFLLTPAESHEKLAQLVAMLAQFEQHIEDDSPLAEVLPSVYNKYPVRYRDYTLRQLCQEMHDLYVSFDVKDLQKAMFR… |
| A0A6M1CNG2 | 58-156 | IPEKCDLNSILFLLTPAESMAKMQHLVAQIARFEQLLEQDAPLKEVLPSVYHAHEARYQGYTIRQLCQEMHDMYVKFNVKQLQKEMF… |
| A0A2X1S4N3 | 1-99 | None |
| A0A655XLQ6 | 1-107 | None |
| A0A377BZR0 | 48-141 | None |
| A0A7U8X2I9 | 114-228 | None |
| A0A0E2BQK1 | 69-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.