DPCstruct | MC53111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 208 |
|---|---|
| Mean domain length (aa) | 163 ± 30 aa |
| Standard deviation of domain lengths | 30.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.05 |
| Pfam Score | 84.87 |
| Assigned Pfam label(s) | CL0341- CL0063- CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TVY8 | 223-410 | AFICAKYAAEKIPAKNFSAMTRLDHNRAIAQIAARCGVDCGSVKKVIIWGNHSSTQFPDVKHAKVIKGGTEIGAYEAVNDVPWIQNE… |
| A0A843HJB0 | 20-176 | LKTYFARRLNINSSEIHTRVIGEHGDNMVPLLSSTTIGGIPLKYFIRDVELDIKEIIQTLRNAGNTIISKKGATEYGPAYAISNLIT… |
| A0A0C9TEH1 | 794-961 | None |
| A0A7C6D7W9 | 146-306 | None |
| A0A1A9UM50 | 14-131 | None |
| A0A7J2HH24 | 4-116 | None |
| A0A522EII6 | 122-320 | None |
| A0A7X8FPP5 | 194-360 | None |
| A0A1L9V6H7 | 35-183 | None |
| A0A7J4JHN3 | 171-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.