DPCstruct | MC53109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 159 ± 29 aa |
| Standard deviation of domain lengths | 28.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 80.21 |
| Assigned Pfam label(s) | CL0044- CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843H5I4 | 2-154 | VGLKGTKTEENLRAALAGESQARVKYEFYASQAKKDGYVEIKDIFQESSDNEKEHAKIWFKLLNGGKVSDTLSNLADAAAGEHYEWT… |
| A0A132HXZ8 | 54-178 | GTGDEMIKDLNAQFMSEATEVGMYLAMSRQADREGYPEIAEAFKRYAFEEADHCSRFAELLGEVVWDTKTNLYKRMIAECGACEEKM… |
| A0A1Z4RX26 | 20-193 | None |
| A0A2L2XAD4 | 280-422 | None |
| A0A2W4NHH6 | 60-195 | None |
| T0CLG3 | 220-337 | None |
| T0CMC2 | 4-142 | None |
| A0A842RRK5 | 4-195 | None |
| A0A1X1YWJ3 | 22-152 | None |
| A0A6A2FMU4 | 48-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.