DPCstruct | MC531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 174 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18967 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3IBI9 | 6-159 | DKRIDRAEKNLQRKLEWISRVDTRVSFIAGVAIAMLGVLANAFSRIICWEWYHYAVFYSAAAFLFVSLFYLYKSQNPKILAPNESLI… |
| A0A1H6FEC6 | 30-222 | KKTKLKNNKKNSKIKIKPKLAELESASGRSIDSMYRNAYRTQLDLIRLADNKSNIMISINGLILSVIVTAWAMIKNHTEAIFFIPIS… |
| A0A2S5TF63 | 8-180 | None |
| A0A7C1YXU0 | 66-260 | None |
| E2Q6K3 | 5-152 | None |
| A0A2K2F6W2 | 15-207 | None |
| A0A258J5G2 | 19-197 | None |
| A0A3A8YF65 | 37-201 | None |
| A0A4S4NGD7 | 221-402 | None |
| A0A0R3QBR8 | 339-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.