DPCstruct | MC53098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 463 |
|---|---|
| Mean domain length (aa) | 219 ± 45 aa |
| Standard deviation of domain lengths | 45.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.36 |
| Pfam Score | 70.87 |
| Assigned Pfam label(s) | PF07833- PF16546- PF15015- PF05620- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5U350 | 24-202 | HHRLAIGYWQAGKLKEAIETFVRLLELDPPNFEARINFGTLLAQMGRLEEAKKQFEIALKAYPSSPEALVNLGLVHFHLGELEEAKK… |
| A0A439TBS3 | 4-228 | PLKIKVLGELVVLRGAREIALPPSKKTRALLAYLVVANRRQRRDHLCRMFWEVPDDPRASLRWSLSKLRHIINQNGDEGCLKADRES… |
| A0A1C5UI64 | 293-443 | None |
| A0A399EFN3 | 2-213 | None |
| A0A6L9J5J3 | 3-230 | None |
| A0A6N6KVW3 | 5-253 | None |
| A0A7W0MX51 | 2-237 | None |
| A0A848UFH3 | 80-327 | None |
| A0A848UJ24 | 2-186 | None |
| A0A852VW13 | 2-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.