DPCstruct | MC5309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.59 |
| Pfam Score | 86.36 |
| Assigned Pfam label(s) | CL0010- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554A487 | 727-842 | IRRQTGDWYQLFWVDANKSDIIYNMNPNNFINDRVQQFQFLDLAKTSGATASALNNFLRGKGTLAGQGQAFIDAGRTHGINDVYLLS… |
| A0A0C1U1Z2 | 149-279 | YGFTLDQFVDKQMNQRPIYNRWAPFNTSASSISVKQFADAERFSVSDYGMYQFLKLNYMEGITASDLDAQLKGKGILNGLGKAFDSA… |
| A0A7X5HZK2 | 395-541 | None |
| A0A098KZC3 | 149-251 | None |
| A0A6I1EUX2 | 304-404 | None |
| A0A5Q2TNK8 | 654-782 | None |
| A0A0A1M6F5 | 865-981 | None |
| T0CMG6 | 1-127 | None |
| W4QM90 | 722-841 | None |
| A0A8B5NN24 | 492-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.