DPCstruct | MC53088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1PZH0 | 11-121 | SDAEPKISEEIPLDVKYPICDVETNLIGDIGVVFDIKRSDGTTCRYTKLQHMLWVFDREDVCNLWDVYRQKYGKDEYKCMKSNDTIE… |
| A0A2U1KPW6 | 566-713 | EEDDGEDHIPHVPLVSWEVHPVQYKDQDINVIHRADGSVKYFSFLSEILTFVDRQDLLKLYSWVTSFYKNKQPTGSGMYLKGDLTVL… |
| A0A6L2J433 | 731-869 | None |
| A0A6L2J8X0 | 561-695 | None |
| A0A6L2JAF5 | 174-332 | None |
| A0A6L2JBD8 | 91-190 | None |
| A0A6L2JGK0 | 1086-1228 | None |
| A0A6L2JDZ6 | 399-521 | None |
| A0A6L2JES9 | 872-1010 | None |
| A0A6L2J2G0 | 1064-1201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.