DPCstruct | MC53086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 170 ± 25 aa |
| Standard deviation of domain lengths | 25.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 63.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444CES7 | 5-111 | QWEQRLDMRTGEVYYINLETGTKTSKDPRTAVVSAVTYSSSYITVKEISSSDDSCSRVGGSDTVADPGESAQVLVAAGCRSCFMYFM… |
| A0A2U1PV48 | 5-156 | SSHNYNNMAASSLQECSGSSEITFNSNIGTSTLLPWEQTLDLKTGEVYYINWTSGMKAKEDPSSSSSSSSRTTNCSYSEDDESSYEE… |
| A0A067KMC1 | 39-198 | None |
| A0A4S8ID41 | 189-330 | None |
| A0A6J1JJG7 | 24-228 | None |
| A0A0B0NAR9 | 8-188 | None |
| A0A7G2EF68 | 27-189 | None |
| A0A7J9IM35 | 1-189 | None |
| V4TQC8 | 129-290 | None |
| D7U8G8 | 29-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.