DPCstruct | MC5308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 141 ± 16 aa |
| Standard deviation of domain lengths | 16.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4RN45 | 20-141 | PLFVSMVFGVAFLYLTGIPYKTYKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGSSGSGTVVALLIILTFAKLAQFANDV… |
| A0A2H6C648 | 2-120 | VFSIPLTAYDNGGQFISIWITPATVCLAIKLENNFQYLKDNYIPILTGLISGVLIHTALILALCLLVSFNGDLFATLYPKSITTAIA… |
| A0A388Q2C2 | 2-144 | None |
| A0A091BX92 | 2-120 | None |
| A0A378FZD2 | 2-118 | None |
| A0A329EQN9 | 18-158 | None |
| A2WMS7 | 1-147 | None |
| A0A378LRT9 | 16-184 | None |
| A0A090SQU8 | 26-167 | None |
| A0A2T6DA69 | 97-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.