DPCstruct | MC53072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497JGL8 | 10-70 | ILENSKPRSYFLKVKCEKCGNTQIIFSAPSRIVRCLSCNEILAYPTGSKAKLNVKKGVVLR |
| A0A554N7K9 | 3-55 | GDFVSVRCPDCENEQTVFGKASTEVACAVCGHALVHPTGGLADIEAEVLDVVE |
| A0A3B5QI07 | 4-82 | None |
| A0A0R3UQE9 | 2-74 | None |
| Q9AW40 | 5-80 | None |
| A0A286Y1Z1 | 1-72 | None |
| M9MI30 | 266-350 | None |
| A0A4U0W8F7 | 5-86 | None |
| A0A3M9Y249 | 153-238 | None |
| A0A0M3QXE7 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.