DPCstruct | MC5307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4RMZ7 | 20-137 | QPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANVSSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEI… |
| K8CT79 | 25-139 | MFNCMLIDLKGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASFEKHRRTAMEWNIPDVEGY… |
| A0A843GI66 | 1-169 | None |
| A0A098BYG3 | 1-163 | None |
| G0VSB7 | 69-200 | None |
| A0A662FDN7 | 273-411 | None |
| A0A0X1TJ54 | 2-118 | None |
| A0A0D0RHB6 | 146-285 | None |
| A0A2X2BNV5 | 1-98 | None |
| A0A432PXS9 | 37-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.