DPCstruct | MC53061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834E5P6 | 72-175 | DFIKKQIEEFNLGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPIMKHPEQIFPKQKATQWGEDGRPFHFLFYTGKQSY… |
| A0A5J4NAB2 | 8-113 | LLEAERKEFECGRKYLAQIMGEDPETFNQDKIDESIKYLFPSALFSPKARPKLKPPEEVFPKKKELQCDSTGRPLHDLFYTRHPNFF… |
| A0A5K3FF62 | 6-152 | None |
| A0A310S9W1 | 17-118 | None |
| A0A7R9ARB8 | 36-143 | None |
| A0A5E4C1T0 | 1-93 | None |
| A0A0V0WC70 | 259-396 | None |
| F6TN93 | 50-159 | None |
| A0A493TR78 | 216-316 | None |
| A0A1I7WUU7 | 110-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.