DPCstruct | MC5306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4RML6 | 23-126 | DKVLVPLAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASELSKTDGSILNLASGVYFANAY… |
| A0A240BZE4 | 1-113 | MLKLAYIDLENLLEKQKEKTVSLYQALKEAEQKLQENPNSKKSKTKHQQVKQQLEKQEKKLAETEQLIETDGTILDLAAALYIYNEH… |
| G8P9S0 | 146-266 | None |
| A0A1L7LKH3 | 93-193 | None |
| A0A6N7UZR8 | 7-112 | None |
| A0A7I8NMR1 | 80-181 | None |
| A0A6I5N0U8 | 408-543 | None |
| A0A7Z7QYJ2 | 199-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.