DPCstruct | MC53057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 203 ± 43 aa |
| Standard deviation of domain lengths | 42.51 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DNV8 | 163-346 | PLFLFSLLSKKHNKVLEQATQSLRGSLSSSDVPLPDYAQDLNVIEEVIRMMLEIINSCLTNSLHHNPNLVYALLYKRDLFEQFRTHP… |
| A0A0C2GG35 | 69-268 | TNCLAALANMSSCFKNLSPIVCQKMIALLELLTKRHVKMVEQMRLAAEQENNEGQPLGYHDDVTALEEGIRTLLEIINSALCGNLRN… |
| A0A7S1GDD9 | 246-550 | None |
| A0A6V7X142 | 266-508 | None |
| A0A813MBX2 | 575-787 | None |
| A0A1I8IS77 | 6-182 | None |
| A0A154PDR2 | 48-255 | None |
| A0A7R9KP80 | 44-227 | None |
| A0A7I8KAR6 | 347-536 | None |
| A0A183K879 | 84-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.