DPCstruct | MC53047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 573 ± 96 aa |
| Standard deviation of domain lengths | 95.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.39 |
| Pfam Score | 78.07 |
| Assigned Pfam label(s) | PF12660- PF19336- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3FFK2 | 22-521 | LLVALHKSGGISFWDVTIPLVDERSIRLCAVDRTYAVPFDPPHHLARPNFIKVIDIDCENIILVVGFTNSRVVCVTYHAYAKIVNKL… |
| A0A137Q4S7 | 513-1154 | VTPYLIETFQTTSAELSHTKQTLHAQIVSICWTPHPDFGVTPVPECNGSLLISGSRAGGILLLRQVFLINTDVISRQLSLRYVDKSL… |
| A0A0M8MTU0 | 316-858 | None |
| F4PXX8 | 115-671 | None |
| K2S8J2 | 317-939 | None |
| A0A177WP49 | 75-670 | None |
| A0A2P2MFC5 | 16-605 | None |
| A0A1V8SKY6 | 100-707 | None |
| A0A6J0YYK1 | 177-812 | None |
| A0A5N5QLJ9 | 20-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.