DPCstruct | MC53046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.21 |
| Pfam Score | 88.30 |
| Assigned Pfam label(s) | CL0033- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3FEC6 | 32-170 | MTVAPQPVYFFDRDPEIFRFVLDYYRTGELHLPTNICGPFVRKELIFWGIDESLIDPCCMPAYMRYDEEKRTKKTLFRDCFEDIDSM… |
| A0A1I8BMW8 | 65-170 | EDAKEYFFDRDPDLFRHILAFYRTGRLHYPQTECLVSYEEELAFFGIIPDLISDCCYEDYKDKKRENQERLMEERIDAPEKRKDLTF… |
| A0A194PR55 | 204-322 | None |
| A0A3P6S2R8 | 1-120 | None |
| A0A0F8C970 | 693-838 | None |
| A0A0F8AG63 | 110-245 | None |
| A0A6J1PYJ6 | 246-363 | None |
| K7H5Y0 | 21-134 | None |
| A0A368F8K5 | 34-176 | None |
| A0A1S8X9U7 | 152-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.