DPCstruct | MC53043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 439 ± 39 aa |
| Standard deviation of domain lengths | 38.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 88.55 |
| Assigned Pfam label(s) | CL0240- CL0701- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3F106 | 74-545 | MSTEKAMSQCLKAFYLVGNPKDYTLYEMNEKDGSELKLDMDEDFRNQLSFDPKRPTLIFRRECSKDPYLSTIKVFSGDLVIDDCEQS… |
| A0A834KI10 | 73-521 | ATTEQVLTSALRAFHITKDSSNFYLTDLYATEETELCDPTPVLNLNRKEGKRPAVFLRFKDNESGEVRVYPGKLQISESFCIVPVTE… |
| A0A3P6W606 | 394-874 | None |
| A0A3M6V4A8 | 257-642 | None |
| A0A5K3EYC3 | 74-544 | None |
| A0A0K0EBU9 | 856-1311 | None |
| A0A5E4Q7Q4 | 1-451 | None |
| A0A2B4RF41 | 38-416 | None |
| A0A183TBG9 | 260-638 | None |
| A0A423SG12 | 110-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.