DPCstruct | MC53041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 204 ± 27 aa |
| Standard deviation of domain lengths | 27.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EY22 | 1-170 | MSLKQRRRAFLDWLLRGLAGNANLRTEYPAFLSSAFSLASAWDLPTSAARLFYVVSLYENWADRDAEESRSMVRDSYTLANSLFYVL… |
| A0A182EL08 | 88-297 | ELQVALEEWPPGPKYLFDSVGERAFFESFYAHPLIPIESITESVREKRMDFLKKCITHNGSPEFTHNLRFHIYDLANDWMLNADEIK… |
| A0A0S7FL77 | 1-192 | None |
| A0A0R3RJG1 | 749-958 | None |
| A0A7M5UT96 | 730-915 | None |
| A0A0X3NU29 | 172-365 | None |
| A0A2D4ISR2 | 192-378 | None |
| A0A553RJ66 | 309-499 | None |
| A0A4Z2CXA4 | 726-963 | None |
| C3Y0K7 | 575-785 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.