DPCstruct | MC53040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 741 ± 54 aa |
| Standard deviation of domain lengths | 54.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EUN9 | 2-729 | VSVLTQKNLELEDKVEKLTEERNDLESLCEMNDELLEGERERQLDLTEQIELARGQIRELLRQLEANKETVADYELTISKFREVVTQ… |
| A0A6J1M958 | 33-699 | MVEQLAEKKMELEDKVKLLEEEIAQLEALEEVHEQLVESNHELELDLREELDLANAAKKDVLRERDAAIETIYDRDQTITKFRELVQ… |
| A0A803Y992 | 368-1124 | None |
| A0A5K3ESM0 | 1-729 | None |
| A0A196SLP8 | 169-849 | None |
| B4QJH8 | 109-941 | None |
| A0A4Z2GCG1 | 175-965 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.